PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10028264
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 268aa    MW: 30269.6 Da    PI: 9.7104
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10028264genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.7e-072571346
                     SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqk 46
                      W+ eE + +  a + +G +    +W ++a+ ++ g+t  +++  ++ 
      Lus10028264 25 EWSREENKEFESALAIYGDErdpdRWMKVASLIP-GKTVSDVIKQYRE 71
                     6*****************99**************.*******999986 PP

2Myb_DNA-binding45.32e-14125169347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ +++++  ++G+g+W+ I+r +  ++t+ q+ s+ qky
      Lus10028264 125 PWTEDEHRRFLKGLMKYGKGDWRNISRNVVVTKTPTQVASHAQKY 169
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575124No hitNo description
PROSITE profilePS512938.4972175IPR017884SANT domain
SMARTSM007175.8E-72275IPR001005SANT/Myb domain
SuperFamilySSF466893.73E-92580IPR009057Homeodomain-like
CDDcd001672.29E-72572No hitNo description
Gene3DG3DSA:1.10.10.605.3E-42572IPR009057Homeodomain-like
PfamPF002492.5E-62571IPR001005SANT/Myb domain
PROSITE profilePS5129419.641117174IPR017930Myb domain
SuperFamilySSF466893.09E-16119175IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-18121173IPR006447Myb domain, plants
SMARTSM007175.6E-12122172IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-10122168IPR009057Homeodomain-like
CDDcd001673.85E-10125170No hitNo description
PfamPF002493.5E-12125169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEARYPHFYS KNDFFSGSSS SQSCEWSREE NKEFESALAI YGDERDPDRW MKVASLIPGK  60
TVSDVIKQYR ELEDDVSEIE AGRVPGYLTR FDSYSSFTLD PFGVRKRPMV GSSKSSDQGR  120
KKGVPWTEDE HRRFLKGLMK YGKGDWRNIS RNVVVTKTPT QVASHAQKYF IRQQQLSGVN  180
DKRRASIHDI TTLNLAGNTF SVAGKRSSSS STTTTTIPIN WNHHDQQQYH PSSSTFFMGL  240
SPYDPNAPST PDVSDVFRMP VGRGIRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530418.11e-86PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-67DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9SWP91e-86B9SWP9_RICCO; DNA binding protein, putative
STRINGPOPTR_0010s20040.11e-82(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.22e-68MYB family protein